Thymosin Beta 4 5mg TB500
TB500 (thymosin beta‑4) is a 43‑amino‑acid research peptide used in studies of actin dynamics and cell migration. Supplied as a lyophilised solid for laboratory work.
From £32.00
In stock
Research use only. Research use only. Not for human consumption or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease. Buyer is responsible for compliance with applicable laws and regulations.
Technical data
Catalogue variant
5mg
SKU: TB500
| Synonyms | Thymosin beta‑4, TB‑500, Timbetasin, TB4 |
|---|---|
| Peptide length | 43 aa |
| Sequence (1-letter) | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Sequence (3-letter) | Ser‑Asp‑Lys‑Pro‑Asp‑Met‑Ala‑Glu‑Ile‑Glu‑Lys‑Phe‑Asp‑Lys‑Ser‑Lys‑Leu‑Lys‑Lys‑Thr‑Glu‑Thr‑Gln‑Glu‑Lys‑Asn‑Pro‑Leu‑Pro‑Ser‑Lys‑Glu‑Thr‑Ile‑Glu‑Gln‑Glu‑Lys‑Gln‑Ala‑Gly‑Glu‑Ser |
| Molecular formula | C212H350N56O78S |
| Molecular weight (g/mol) | 4963.5 |
| Purity | Typically ≥98% (HPLC) — see lot COA |
| Form | Lyophilised solid |
| Appearance | White/off‑white solid (may vary by batch) |
| Solubility | Water and aqueous buffers (prepare per SOP) |
| Storage (powder) | −20°C, dry, sealed |
| Storage (solution) | Aliquot and store ≤−20°C; avoid repeat freeze–thaw |
Shipping
See our Shipping & returns page for delivery times and returns.
Research use disclaimer
Research use only. Not for human consumption or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease. Buyer is responsible for compliance with applicable laws and regulations.